PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009772007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 228aa    MW: 25685.6 Da    PI: 6.7886
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009772007.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.18.6e-3352107460
     ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                      rY+eClkNhA+ +Gg+avDGCgEf+p+ geegt +alkCaAC+CHRnFHR+eve e
  XP_009772007.1  52 PRYRECLKNHAVGIGGQAVDGCGEFLPA-GEEGTLDALKCAACNCHRNFHRKEVEGE 107
                     69*************************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-2336105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.3E-3053104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.2E-2953104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.1954103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.07E-20150226IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-31155227IPR009057Homeodomain-like
TIGRFAMsTIGR015657.6E-24165221IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MEFDEEHEDQ EDEIANISQI PATTENNYQE FGEGGPISQA AATLRKNNVP SPRYRECLKN  60
HAVGIGGQAV DGCGEFLPAG EEGTLDALKC AACNCHRNFH RKEVEGEILN FHHTTPPPIL  120
HHPAHHYPYR YLQRPLALPS VSSREDIEDY VSNPTSSGGG GSGSRKRFRT KFTQDQKEKM  180
FAFAEGLGWR IQKENDAAVQ QFCAETNIRR QVFKVWMHNN KHTLGKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-271662231875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009772007.11e-174PREDICTED: zinc-finger homeodomain protein 2-like
RefseqXP_016482443.11e-174PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ6YXH54e-70ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
SwissprotQ9SB613e-70ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA5BZD72e-77A5BZD7_VITVI; Putative uncharacterized protein
TrEMBLF6H1063e-78F6H106_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g07140.t011e-77(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.15e-63homeobox protein 22